PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G068700.1
Common NameB456_001G068700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 319aa    MW: 35016.9 Da    PI: 8.7447
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G068700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.32.9e-32190243255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Gorai.001G068700.1 190 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 243
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.51E-15187244IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-29188244IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-24190244IPR006447Myb domain, plants
PfamPF002494.1E-7191242IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MSDKGDFTSL NRIPDLSLHI SPPNSAPSSI CAAGDSSFDI WRKDDGVNPK SHSDSSIKPA  60
SQADTQLSLA NPTTSALEAE SESPWEKKSF APLARTDDDN IYHGISLLDV SGLKPIKGIP  120
VYSNYAWSYS SYNCSSSSAL HSPPRFNGIS METLRPHFYP HQLGGSDFCN SMVRSRFIPK  180
LQSKRNMRAP RMRWTSSLHA RFVHAVELLG GHERATPKSV LELMDVKDLT LAHVKSHLQM  240
YRTIKSTDKP ASSSDGSKSE EDYWAAAAPR QRSGSPDSSL NHDNNNAAAN SNLWSNSSRY  300
VSLSLSTSFY FSKNIISI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469069.10.0PREDICTED: transcription repressor KAN1-like isoform X3
SwissprotQ93WJ91e-55KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A0D2NF650.0A0A0D2NF65_G
STRINGPOPTR_0012s03900.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-50G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]